Category: DEFAULT

DEFAULT by Taucage

The Unknown (Original Mix) - Anne Savage vs. Marzz - The Unknown (File, MP3)


Download The Unknown (Original Mix) - Anne Savage vs. Marzz - The Unknown (File, MP3)
2006
Label: Detox Records - TOX 020 • Format: 4x, File MP3 320 kbps • Country: Netherlands • Genre: Electronic • Style: Hard Trance, Tech Trance


Sitemap

La Vie En Rose - Gilles Valiquette - Deuxième Arrêt (CD, Album), Heal Me - Circle Of Silence - The Supremacy Of Time (CD, Album), The Protector - Future Disciple - The Protector (File, MP3), Klimazone_N 11 / Soundinstallation - Various - Liquid Sky Cologne Presentz Klimazone_N (CD), La Traviata - Various - Die Schönsten Liebesszenen Der Oper (CD), Gone With The Fog - Various - Wastelands (File, MP3), I Want To Old Your Hand - The Beatles - Danmark & Nederland June 1964 (CD), Golden Belt - T. Rex - Bolans Zip Gun (CD, Album), Rape Me - Nirvana - In Utero (Cassette, Album), Old - Lisa Mezzacappas Bait & Switch - Comeuppance (CD, Album)

9 thoughts on “ The Unknown (Original Mix) - Anne Savage vs. Marzz - The Unknown (File, MP3) ”

  1. 1) Select a file to send by clicking the "Browse" button. You can then select photos, audio, video, documents or anything else you want to send. The maximum file size is MB. 2) Click the "Start Upload" button to start uploading the file. You will see the progress of the file transfer.
    Reply
  2. Download Anne Savage songs, singles and albums on MP3. Over one million legal MP3 tracks available at Juno Download. Anne Savage.
    Reply
  3. Subscribe now to receive all the new music Unknown To The Unknown releases, including 97 back-catalog items, delivered instantly to you via the Bandcamp app for iOS and Android. You’ll also get access to subscriber-only exclusives like this track.
    Reply
  5. Feb 10,  · Ricardo Villalobos approved, Huge edit!! Limited one sided hand-stamped vinyl only release. Buy wax here: boarhetdistcaspasi.asinvihysihamnalchkastpiberpemit.co
    Reply
  6. Anne Savage Vs Marzz-The Unknown-WEBVeRsAcE Anne Savage Vs Vinylgroover and the Red Head - Pay Attention-(TRAFFIC)-Advance-VinylNRG Anne Savage Vs Vinylgroover and the Red Hed-Dot Com Dot Co Dot You Kay-WEBVeRsAcE Anne Savage vs. Kidd Kaos - Pure Sensation-(SIREN)-WEBEKM Anne Savage-Ideal Weekender Mini Mix .
    Reply
  7. All Hard Trance music downloads on MP3 and WAV in stock S Back Catalogue tracks. All Hard Trance music downloads on MP3 and WAV in stock S Back Catalogue tracks. GENRES. All Genres Balearic/Downtempo Bass Breakbeat Disco/Nu-Disco DJ Tools Drum And Bass Dubstep Deep Dubstep Dirty Dubstep/Trap/Grime EDM Electro Euro Dance/Pop Dance Footwork/Juke.
    Reply
  8. 9) Anne Savage Vs Marzz - The Unknown (Gleave Mix) [Detox] 10) Vinylgroover & The Red Hed - Attitude [Traffic] 11) Ferry Corsten Feat Guru - Junk (Bart Claessen Mix) [Positiva] John Askew In The Mix 1) Chris Chambers & Static Blue - Dynamica- (Sassot Broken Toys Mix) (Alterego) 2) Magitman - Wusik Feeling- (D-Nox Beckers Mix) (CDR).
    Reply
  9. Nov 03,  · KUTSKI’S FREERANGE MIX Anne Savage vs Marzz — The Unknown (Gleave Mix) [Detox] Mark Sherry vs. James Allan — Red Alert (Public Domain’s Dirty Tech Trance Mix) [Detox] Marzz — Orbiter [Detox] Joey V — Chopperchunk [Detox] Dr Willis vs Mark Sherry — Here Comes The Drums [Detox] TRIED & TESTED
    Reply

Leave a Reply

Your email address will not be published. Required fields are marked *