DEFAULT

Medley: Sophisticated Lady Lover


Download Medley: Sophisticated Lady Lover



Sitemap

Black Gold - Millencolin - For Monkeys (CD, Album), The Visit - Ferm Beats / Accurate (2) - Jaadu/Escape From The Zoo (Cassette, Album), Waiting - Luther Grosvenor - Under Open Skies (Vinyl, LP, Album), Acid Revenge - Lady Tom - Hardstyle Queen (CD), Albertina, Носки - Сектор Газа - Избранное II (Cassette), The Hunt - Jimmy Power - Irish Dances - Reels - Jigs - Set Dances & Hornpipes (Vinyl, LP), What The Eye Sees - Acts Of Tragedy - Cursed Words (CDr, Album), In Motion - Ital Tek - Nebula Dance (CD, Album), The Way That You Are - Daniel ODonnell - From Daniel With Love (CD, Album), Blue Lou - Chick Webb - In The Groove (Vinyl, LP)

9 thoughts on “ Medley: Sophisticated Lady Lover ”

  1. Jun 19,  · Sophisticated Lady (Live) Ella Fitzgerald & Joe Pass Vocal · Preview SONG TIME Ella Introduction of Joe (Live) Ella Fitzgerald. 1. PREVIEW I'm Beginning to See the Light (Live) 2. PREVIEW Medley: I Got It Bad (And That Ain't Good) [Live] 3. PREVIEW.
  2. Medley (Don't Get Around Much Anymore/In A Sentimental Mood/Mood Indigo/I'm Beginning To See The Light/Sophisticated Lady/Caravan/It Don't Mean A Thing/Solitude/I Let A Song Go Out Of My Heart 8. Lover Come Back To Me (With Billie Holiday)Brand: Rhino Entertainment Company.
  3. 9 Medley: Whispering / Somebody Love 10 Love Theme From Romeo And Juliet 11 Main Theme From Exodus 12 Medley: Holly Holy / Sweet Caroline 13 Born Free 14 Love Is Blue 15 Raindrops Keep Fallin' On My Head 16 Sophisticated Lady.
  4. Description Four Ellington hits - Don't Get Around Much Anymore, Do Nothin' 'Till You Hear from Me, Sophisticated Lady, and It Don't Mean a Thing (If It Ain't Got That Swing) - are given special treatment in this monster medley. Full instrumentation is required, and the arrangement is moderately advanced, but the result is great music!
  5. Medley: A. Don't Get Around Much Anymore / B. In A Sentimental Mood / C. Mood Indigo / D. I'm Beginning To See The Light / E. Sophisticated Lady / F. Caravan / G. It Don't Mean A Thing / H. Solitude / I. I Let A Song Go Out Of My Heart; 8. Lover Come Back To MePrice: $
  6. Recorded a few years before Teddy Wilson's death (the exact date is not listed on this CD), this edition of Marian McPartland's Piano Jazz is quite valuable. Wilson talks about his early days, his practice routine, rambles a bit and plays a variety of swing standards. McPartland has "Marian's Motif" as her feature but best are the piano duets on "I'll Remember April" and a fun version of Missing: Lady Lover.
  7. "Sophisticated Lady" is a jazz standard, composed as an instrumental in by Duke Ellington. Background. Additional credit is given to publisher Irving Mills whose words were added to the song by Mitchell Parish. The words met with approval from Ellington, who described them as "wonderful—but not entirely fitted to my original conception".
  8. Cover versions. Diana Ross recorded the song in for the soundtrack for the film Lady Sings the Blues, in which she portrayed Billie Holiday.. Patti LaBelle recorded the song in for her sixth and breakthrough album I'm in Love Again.. In , Whitney Houston performed the song as part of the set list during her I'm Your Baby Tonight boarhetdistcaspasi.asinvihysihamnalchkastpiberpemit.con also performed the tune in a medley.
  9. It is beingreleased now on CD for the first time in the U.S. "Side 1" from the original vinyl LP consists of a medley made up of four songs made famous by Duke Ellington - "Prelude To A Kiss", "I Got It Bad And That Ain't Good", "Sophisticated Lady" and "In A Sentimental Mood."5/5(2).

Leave a Reply

Your email address will not be published. Required fields are marked *